PDB entry 4lrr

View 4lrr on RCSB PDB site
Description: Ternary complex between E. coli thymidylate synthase, dUMP, and F9
Class: transferase
Keywords: Thymidine monophosphate synthesis, N-terminal acetylated methionine, beta-mercaptoethanol modified cysteine, TRANSFERASE
Deposited on 2013-07-20, released 2013-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.173
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:83334]
    Gene: thyA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lrra_
  • Heterogens: SO4, CF9, UMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lrrA (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai