PDB entry 4lro

View 4lro on RCSB PDB site
Description: Crystal structure of spermidine inhibited Ribosome inactivating protein from Momordica balsamina
Class: hydrolase
Keywords: Ribosome inactivating protein, Complex hydrolase, Ligand binding, Hydrolase, Spermidine
Deposited on 2013-07-20, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rRNA N-glycosidase
  Species: Momordica balsamina [TaxId:3672]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D9J2T9 (0-245)
  Domains in SCOPe 2.08: d4lroa_
• Heterogens: NAG, GOL, SPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lroA (A:)
  dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
  tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
  prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
  pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
  lntkni