PDB entry 4lrg

View 4lrg on RCSB PDB site
Description: Structure of BRD4 bromodomain 1 with a dimethyl thiophene isoxazole azepine carboxamide
Class: transcription regulator/inhibitor
Keywords: BET inhibitor, Brd4 first bromodomain, TRANSCRIPTION REGULATOR-INHIBITOR complex
Deposited on 2013-07-19, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, BRD4_HUMAN, HUNK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60885 (1-127)
      • expression tag (0)
    Domains in SCOPe 2.08: d4lrga1, d4lrga2
  • Heterogens: 1XB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lrgA (A:)
    gstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyyki
    iktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqk
    inelptee