PDB entry 4lr6

View 4lr6 on RCSB PDB site
Description: Structure of BRD4 bromodomain 1 with a 3-methyl-4-phenylisoxazol-5-amine fragment
Class: transcription regulator/inhibitor
Keywords: BET inhibitor, Brd4 first bromodomain, TRANSCRIPTION REGULATOR-INHIBITOR complex
Deposited on 2013-07-19, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, BRD4_HUMAN, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lr6a_
  • Heterogens: FMT, 1XA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lr6A (A:)
    gstnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyyki
    iktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqk
    inelptee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lr6A (A:)
    stnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
    ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
    nelpt