PDB entry 4lqz

View 4lqz on RCSB PDB site
Description: crystal structure of a duf4909 family protein (sav1798) from staphylococcus aureus subsp. aureus mu50 at 1.92 a resolution
Deposited on 2013-07-19, released 2013-08-07
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: SAV1798
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99T72 (19-End)
      • leader sequence (12-18)
  • Heterogens: PO4, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lqzA (A:)
mgsdkihhhhhhenlyfqgqrfeiqqhnetigsiyfsadyahirgiekgtakyfidkvgs
krylfieyipdnvlnckpdfwktlkykkdkvtyyvylienlddevfhlsalqdmnripid
iaddvatmgksphqndrmtlklnknn

    Sequence, based on observed residues (ATOM records):
    >4lqzA (A:)
enlyfqgqrfeiqqhnetigsiyfsadyahirgiekgtakyfidkvgskrylfieyipdn
vlnckpdfwktlkykkdkvtyyvylienlddevfhlsalqdmnripidiaddvatmgksp
hqndrmtlkln