PDB entry 4lqv

View 4lqv on RCSB PDB site
Description: Thrirty minutes iron loaded frog M ferritin
Class: oxidoreductase
Keywords: thirty minutes iron soaking, four helix bundle, oxidoreductase, ferroxidase
Deposited on 2013-07-19, released 2014-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lqva_
  • Heterogens: FE2, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lqvA (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lqvA (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv