PDB entry 4lqr

View 4lqr on RCSB PDB site
Description: structure of cbm32-3 from a family 31 glycoside hydrolase from clostridium perfringens
Deposited on 2013-07-19, released 2014-07-23
The last revision was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase, family 31/fibronectin type III domain protein
    Species: Clostridium perfringens [TaxId:195103]
    Gene: CPF_1301
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TRJ3 (21-166)
      • expression tag (11-20)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lqrA (A:)
mhhhhhhitslykkagsefaldsskleaiyatseadrdykenavdgdentiwhsayqaad
klpvsitikldkaydlnqidylprqnsrnghvteykietsldnenwtevrtgnlevneag
nalanrgynpirfntinaqylrftalktlgdtnnkyasaaelvfygk

    Sequence, based on observed residues (ATOM records):
    >4lqrA (A:)
ykkagsefaldsskleaiyatseadrdykenavdgdentiwhsayqaadklpvsitikld
kaydlnqidylprqnsrnghvteykietsldnenwtevrtgnlevneagnalanrgynpi
rfntinaqylrftalktlgdtnnkyasaaelvfygk