PDB entry 4lqm

View 4lqm on RCSB PDB site
Description: EGFR L858R in complex with PD168393
Class: transferase/transferase inhibitor
Keywords: EGFR, Kinase, PD168393, 34-jab, transferase-transferase inhibitor complex
Deposited on 2013-07-19, released 2014-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (166)
    Domains in SCOPe 2.07: d4lqma_
  • Heterogens: DJK, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lqmA (A:)
    gspsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lqmA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikeltspkankei
    ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeegkvpikwmalesi
    lhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymi
    mvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsalmdeedmddvvdad
    eylip