PDB entry 4lqc

View 4lqc on RCSB PDB site
Description: The crystal structures of the Brucella protein TcpB and the TLR adaptor protein TIRAP show structural differences in microbial TIR mimicry.
Deposited on 2013-07-17, released 2013-12-04
The last revision was dated 2014-04-09, with a file datestamp of 2014-04-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TcpB
    Species: Brucella melitensis [TaxId:29459]
    Gene: NC_003317
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YF53 (Start-137)
      • engineered mutation (11)
      • engineered mutation (14)
      • expression tag (138-140)
  • Chain 'B':
    Compound: TcpB
    Species: Brucella melitensis [TaxId:29459]
    Gene: NC_003317
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YF53 (Start-137)
      • engineered mutation (11)
      • engineered mutation (14)
      • expression tag (138-140)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lqcA (A:)
    meaeeeydffiahaiedkeafvqdlvaalrdlgakifydaytlkvgdslrrkidqglans
    kfgivvlsehffskqwpareldgltameiggqtrilpiwhkvsydevrrfspsladkval
    ntslksveeiakelhslisawshpqfek
    

    Sequence, based on observed residues (ATOM records):
    >4lqcA (A:)
    eydffiahaiedkeafvqdlvaalrdlgakifydaytlkvgdslrrkidqglanskfgiv
    vlsehffskqwpareldglttrilpiwhkvsydevrrfspsladkvalntslksveeiak
    elhslisaw
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4lqcB (B:)
    meaeeeydffiahaiedkeafvqdlvaalrdlgakifydaytlkvgdslrrkidqglans
    kfgivvlsehffskqwpareldgltameiggqtrilpiwhkvsydevrrfspsladkval
    ntslksveeiakelhslisawshpqfek
    

    Sequence, based on observed residues (ATOM records):
    >4lqcB (B:)
    eydffiahaiedkeafvqdlvaalrdlgakifydaytlkvgdslrrkidqglanskfgiv
    vlsehffskqwpareldgltametrilpiwhkvsydevrrfspsladkvalntslksvee
    iakelhslisaw