PDB entry 4lq7

View 4lq7 on RCSB PDB site
Description: Fifteen minutes iron loaded frog M ferritin
Class: oxidoreductase
Keywords: four helix bundle, oxidoreductase, ferroxidase
Deposited on 2013-07-17, released 2014-08-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lq7a_
  • Heterogens: FE, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lq7A (A:)
    mvsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheer
    ehaekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatd
    kvdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lq7A (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk