PDB entry 4lq4

View 4lq4 on RCSB PDB site
Description: crystal structure of mutant ribosomal protein L1 from Methanococcus jannaschii with deletion of 8 residues from C-terminus
Deposited on 2013-07-17, released 2014-07-02
The last revision was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Methanocaldococcus jannaschii [TaxId:243232]
    Gene: MJ0510, rpl1, rplA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: TLA, IPA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4lq4A (A:)
mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
vlnvvakkyekglyhikdayvkltmgpavkv