PDB entry 4lq1

View 4lq1 on RCSB PDB site
Description: Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose
Class: transferase
Keywords: Branching enzyme, maltohexaose, linear polysaccharide, starch biosynthetic pathway, alpha/beta barrel, TRANSFERASE
Deposited on 2013-07-17, released 2015-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lq1a1, d4lq1a2, d4lq1a3
  • Chain 'B':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lq1b1, d4lq1b2, d4lq1b3
  • Chain 'C':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lq1c1, d4lq1c2, d4lq1c3
  • Chain 'D':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lq1d1, d4lq1d2, d4lq1d3
  • Heterogens: BGC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lq1A (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lq1A (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyggrenleaieflrnt
    nrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqy
    hhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpg
    kkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfd
    pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
    smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lq1B (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lq1B (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdipnefggren
    leaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldy
    mkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlra
    yygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrh
    hkamheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqp
    gkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lq1C (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lq1C (C:)
    hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
    fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkkan
    qfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdgs
    wgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnly
    ehsliynygrrevsnflvgnalywierfgidalrvdavasmiyrdnefggrenleaiefl
    rntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvy
    rqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwa
    fpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamhel
    dfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreil
    ntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lq1D (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lq1D (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdynefggrenlea
    ieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkl
    dpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayyg
    wmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhka
    mheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkw
    reilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae