PDB entry 4lpx

View 4lpx on RCSB PDB site
Description: Crystal structure of TENCON variant D4
Class: de novo protein
Keywords: fibronectin type III fold, alternate scaffold, DE NOVO PROTEIN
Deposited on 2013-07-16, released 2014-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TENCON variant D4
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LPX (0-End)
    Domains in SCOPe 2.08: d4lpxa1, d4lpxa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4lpxA (A:)
mlpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlipfpnlsnplsaefttgghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4lpxA (A:)
mlpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlipfpnlsnplsaefttgghhh