PDB entry 4lpm

View 4lpm on RCSB PDB site
Description: Frog M-ferritin with magnesium, D127E mutant
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2013-07-16, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, middle subunit
    Species: Rana catesbeiana [TaxId:8400]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07798 (0-173)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d4lpma_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lpmA (A:)
    vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
    haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
    vdphlcefleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes