PDB entry 4lpi

View 4lpi on RCSB PDB site
Description: A sperm whale myoglobin double mutant L29H/F43Y Mb with a distal hydrogen-bonding network
Class: oxygen transport
Keywords: Enzyme Function Initiative, distal heme hydrogen-bonding network, Nitrite redutase, OXYGEN TRANSPORT
Deposited on 2013-07-16, released 2014-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.181
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (29)
      • engineered mutation (43)
    Domains in SCOPe 2.05: d4lpia_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lpiA (A:)
    mvlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekydrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpiA (A:)
    vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekydrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg