PDB entry 4lpc

View 4lpc on RCSB PDB site
Description: Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose
Class: transferase
Keywords: Branching enzyme, maltoheptaose, linear polysaccharide, starch biosynthetic pathway, TRANSFERASE
Deposited on 2013-07-16, released 2015-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lpca1, d4lpca2, d4lpca3
  • Chain 'B':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lpcb1, d4lpcb2, d4lpcb3
  • Chain 'C':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lpcc1, d4lpcc2, d4lpcc3
  • Chain 'D':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli [TaxId:562]
    Gene: glgB, b3432, JW3395
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lpcd1, d4lpcd2, d4lpcd3
  • Heterogens: GOL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lpcA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpcA (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrggrenleaieflrn
    tnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrq
    yhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafp
    gkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldf
    dpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilnt
    dsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lpcB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpcB (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdprentliynygrrevsnflvgnalywierfgidalrvdavasmiyrdipnefggr
    enleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtl
    dymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanl
    rayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnlty
    rhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfgin
    qpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lpcC (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpcC (C:)
    hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
    fipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkkan
    qfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdgs
    wgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnly
    ehsliynygrrevsnflvgnalywierfgidalrvdavasmiyrenleaieflrntnril
    geqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdk
    ltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpgkkll
    fmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfdpygf
    ewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntdsmhy
    hgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lpcD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lpcD (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdgrenleaieflr
    ntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyr
    qyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwaf
    pgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheld
    fdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreiln
    tdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae