PDB entry 4lp8

View 4lp8 on RCSB PDB site
Description: A Novel Open-State Crystal Structure of the Prokaryotic Inward Rectifier KirBac3.1
Class: metal transport
Keywords: Metal Transport, Potassium Channel, Membrane
Deposited on 2013-07-15, released 2013-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.183
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inward rectifier potassium channel Kirbac3.1
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9N164 (Start-294)
      • engineered mutation (128)
      • engineered mutation (204)
      • expression tag (295-298)
    Domains in SCOPe 2.06: d4lp8a1, d4lp8a2, d4lp8a3
  • Heterogens: PEG, K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lp8A (A:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaarliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrlpifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lp8A (A:)
    rilnsdgssnitrlggwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvie
    narpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliyarft
    rptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfh
    dltltrsrlpifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvha
    rhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhh