PDB entry 4lp2

View 4lp2 on RCSB PDB site
Description: Crystal structure of monomeric ligand binding domain of S. typhimurium CysB, a LysR transcriptional regulator at 2.2A
Class: gene regulation
Keywords: LTTR, CysB, wHTH motif, alpha/beta fold, Rossmann fold, Transcription regulation, O-acetyl serine, N-acetyl serine binding,DNA binding, GENE REGULATION
Deposited on 2013-07-15, released 2014-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: HTH-type transcriptional regulator CysB
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: cysB, STM1713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lp2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lp2B (B:)
ehtwpdkgslyiatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadf
aiatealhlyddlvmlpcyhwnrsivvtpdhplaatssvtiealaqyplvtytfgftgrs
eldtafnragltprivftatdadviktyvrlglgvgviasmavdpladpdlvridahdif
shsttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsneeieamfqdiklpek