PDB entry 4lov

View 4lov on RCSB PDB site
Description: Crystal structure of FimH in complex with Heptylmannoside
Class: carbohydrate binding protein
Keywords: Pilus subunit, Ig fold, CARBOHYDRATE BINDING PROTEIN
Deposited on 2013-07-13, released 2014-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: Escherichia coli [TaxId:562]
    Gene: fimH, b4320, JW4283
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lova_
  • Heterogens: KGM, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lovA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt