PDB entry 4lou

View 4lou on RCSB PDB site
Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in the absence of halide
Class: membrane protein, tranport protein
Keywords: Cl-/H+ antiporter, membrane protein, tranport protein
Deposited on 2013-07-13, released 2013-08-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: b0155, clcA, eriC, JW5012, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (1-444)
      • engineered mutation (132)
    Domains in SCOPe 2.03: d4loua_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:83333]
    Gene: b0155, clcA, eriC, JW5012, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019 (1-End)
      • engineered mutation (132)
    Domains in SCOPe 2.03: d4loub_
  • Chain 'C':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOU (0-221)
    Domains in SCOPe 2.03: d4louc1, d4louc2
  • Chain 'D':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOU (0-210)
    Domains in SCOPe 2.03: d4loud1, d4loud2
  • Chain 'E':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOU (Start-221)
    Domains in SCOPe 2.03: d4loue1, d4loue2
  • Chain 'F':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOU (0-210)
    Domains in SCOPe 2.03: d4louf1, d4louf2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4louA (A:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4louA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4louB (B:)
    mrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadny
    pllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgg
    lgtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnapla
    gilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwly
    lilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgg
    gfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmva
    velfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatll
    aqftggkplysailartlakqeaeqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4louB (B:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4louC (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4louD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4louE (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >4louE (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4louF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra