PDB entry 4los

View 4los on RCSB PDB site
Description: c1s cub2-ccp1
Deposited on 2013-07-13, released 2013-08-07
The last revision was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1s subcomponent heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: C1S
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4losA (A:)
gvncsgdvftaligeiaspnypkpypensrceyqirlekgfqvvvtlrredfdveaadsa
gncldslvfvagdrqfgpycghgfpgplnietksnaldiifqtdltgqkkgwklryhgdp
mpcpkedtpnsvwepakakyvfrdvvqitcldgfevvegrvgatsfystcqsngkwsnsk
lkcqpvd