PDB entry 4lor

View 4lor on RCSB PDB site
Description: C1s CUB1-EGF-CUB2 in complex with a collagen-like peptide from C1q
Class: HYDROLASE/protein binding
Keywords: CUB domain, EGF-like domain, protein collagen complex, C1 complex, HYDROLASE-protein binding complex
Deposited on 2013-07-13, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1s subcomponent heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: C1S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lora1, d4lora2, d4lora3
  • Chain 'B':
    Compound: collagen-like peptide from C1q
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOR
  • Chain 'C':
    Compound: collagen-like peptide from C1q
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOR
  • Chain 'D':
    Compound: collagen-like peptide from C1q
    Database cross-references and differences (RAF-indexed):
    • PDB 4LOR
  • Heterogens: CA, NA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lorA (A:)
ptmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgd
teegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatdinect
dfvdvpcshfcnnfiggyfcscppeyflhddmkncgvncsgdvftaligeiaspnypkpy
pensrceyqirlekgfqvvvtlrredfdveaadsagncldslvfvagdrqfgpycghgfp
gplnietksnaldiifqtdltgqkkgwklryhgdpm

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.