PDB entry 4lol

View 4lol on RCSB PDB site
Description: Crystal structure of mSting in complex with DMXAA
Class: immune system
Keywords: innate immunity, IMMUNE SYSTEM
Deposited on 2013-07-12, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-02, with a file datestamp of 2013-09-27.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.184
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Mus musculus [TaxId:10090]
    Gene: Tmem173, Eris Mita, Mpys, Sting
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lola_
  • Chain 'B':
    Compound: Stimulator of interferon genes protein
    Species: Mus musculus [TaxId:10090]
    Gene: Tmem173, Eris Mita, Mpys, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3TBT3 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d4lolb1, d4lolb2
  • Heterogens: 1YE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lolA (A:)
    svahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvpdnls
    vvdpnirfrdmlpqqnidragiknrvysnsvyeilengqpagvcileyatplqtlfamsq
    dakagfsredrleqaklfcrtleeiledvpesrnncrlivyqeptdgnsfslsqevlrhi
    rqeekeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lolA (A:)
    vahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldgvpdnlsvv
    dpnirfrdmlpqqnidragiknrvysnsvyeilengqpagvcileyatplqtlfamsqda
    kagfsredrleqaklfcrtleeiledvpesrnncrlivyqeptdsfslsqevlrhirq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lolB (B:)
    svahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldcgvpdnls
    vvdpnirfrdmlpqqnidragiknrvysnsvyeilengqpagvcileyatplqtlfamsq
    dakagfsredrleqaklfcrtleeiledvpesrnncrlivyqeptdgnsfslsqevlrhi
    rqeekeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lolB (B:)
    svahglawsyyigylrlilpglqarirmfnqlhnnmlsgagsrrlyilfpldgvpdnlsv
    vdpnirfrdmlpqqnidragiknrvysnsvyeilengqpagvcileyatplqtlfamsqd
    akagfsredrleqaklfcrtleeiledvpesrnncrlivyqepslsqevlrhirq