PDB entry 4lnp

View 4lnp on RCSB PDB site
Description: The first SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin
Class: signaling protein
Keywords: sh3 domain, cell migration, proline rich peptide, focal adhesion, SIGNALING PROTEIN
Deposited on 2013-07-11, released 2014-05-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.14
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sorbin and SH3 domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0894, KIAA1296, SH3D5, SORBS1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lnpa_
  • Chain 'B':
    Compound: vinculin
    Species: Homo sapiens [TaxId:9606]
    Gene: VCL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnpA (A:)
    emrparakfdfkaqtlkelplqkgdivyiykqidqnwyegehhgrvgifprtyiellppa
    e
    

  • Chain 'B':
    No sequence available.