PDB entry 4lno

View 4lno on RCSB PDB site
Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: form two of GS-1
Class: ligase
Keywords: alpha/beta, tnra, glnr, LIGASE
Deposited on 2013-07-11, released 2013-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.196
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lnoa1, d4lnoa2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lnob1, d4lnob2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lnoc1, d4lnoc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lnod1, d4lnod2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lnoe1, d4lnoe2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lnof1, d4lnof2
  • Heterogens: MG, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnoA (A:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnoB (B:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnoC (C:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnoD (D:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnoE (E:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnoF (F:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy