PDB entry 4lnn

View 4lnn on RCSB PDB site
Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of apo form of GS
Class: ligase
Keywords: glutamine synthetase, enzyme, dodecamer, alpha/beta, LIGASE
Deposited on 2013-07-11, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.217
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnna1, d4lnna2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnb1, d4lnnb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnc1, d4lnnc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnd1, d4lnnd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnne1, d4lnne2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnf1, d4lnnf2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnng1, d4lnng2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnh1, d4lnnh2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnni1, d4lnni2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnj1, d4lnnj2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnk1, d4lnnk2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnnl1, d4lnnl2
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lnnA (A:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnA (A:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    pcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleap
    apidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiew
    dmfrtqvhpwereqymsqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lnnB (B:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnB (B:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    pcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleap
    apidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiew
    dmfrtqvhpwereqymsqy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lnnC (C:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnC (C:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    cyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapa
    pidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewd
    mfrtqvhpwereqymsqy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lnnD (D:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnD (D:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    pcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleap
    apidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiew
    dmfrtqvhpwereqymsqy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4lnnE (E:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnE (E:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    cyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapa
    pidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewd
    mfrtqvhpwereqymsqy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lnnF (F:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnF (F:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvc
    yvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapap
    idrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdm
    frtqvhpwereqymsqy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4lnnG (G:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnG (G:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    cyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapa
    pidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewd
    mfrtqvhpwereqymsqy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4lnnH (H:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnH (H:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvc
    yvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapap
    idrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdm
    frtqvhpwereqymsqy
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4lnnI (I:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnI (I:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvy
    vawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapapi
    drniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewdmf
    rtqvhpwereqymsqy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4lnnJ (J:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnJ (J:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    cyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapa
    pidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewd
    mfrtqvhpwereqymsqy
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4lnnK (K:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnK (K:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    cyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkleapa
    pidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeiewd
    mfrtqvhpwereqymsqy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lnnL (L:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lnnL (L:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gpcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknklea
    papidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakeie
    wdmfrtqvhpwereqymsqy