PDB entry 4lnk

View 4lnk on RCSB PDB site
Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-glutamate-AMPPCP complex
Class: ligase
Keywords: alpha-beta, LIGASE
Deposited on 2013-07-11, released 2013-10-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.2
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lnka1, d4lnka2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lnkb1, d4lnkb2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lnkc1, d4lnkc2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lnkd1, d4lnkd2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lnke1, d4lnke2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lnkf1, d4lnkf2
  • Heterogens: GLU, ADP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnkA (A:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnkB (B:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnkC (C:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnkD (D:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnkE (E:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lnkF (F:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy