PDB entry 4lni

View 4lni on RCSB PDB site
Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex
Class: ligase
Keywords: Alpha-beta, TnrA, GlnrA, LIGASE
Deposited on 2013-07-11, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.166
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnia1, d4lnia2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnib1, d4lnib2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnic1, d4lnic2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnid1, d4lnid2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnie1, d4lnie2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnif1, d4lnif2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnig1, d4lnig2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnih1, d4lnih2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnii1, d4lnii2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnij1, d4lnij2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnik1, d4lnik2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: glnA, BSU17460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnil1, d4lnil2
  • Heterogens: P3S, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniA (A:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniB (B:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniC (C:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniD (D:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniE (E:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniF (F:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniG (G:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniH (H:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniI (I:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4lniJ (J:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lniJ (J:)
    ytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfvri
    eesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemedlg
    fsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgfei
    eashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvngsg
    mhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvpgy
    eapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknkle
    apapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieakei
    ewdmfrtqvhpwereqymsqy
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniK (K:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lniL (L:)
    akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
    rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpfegdprnnlkrilkemed
    lgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdlgencrrdivleleemgf
    eieashhevapgqheidfkyagavrscddiqtfklvvktiarkhglhatfmpkplfgvng
    sgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhatsftavtnptvnsykrlvp
    gyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpylalsvllaagldgiknk
    leapapidrniyvmskeermengivdlpatlaealeefksnevmvkalgehlfehfieak
    eiewdmfrtqvhpwereqymsqy