PDB entry 4lnd

View 4lnd on RCSB PDB site
Description: Crystal structure of human apurinic/apyrimidinic endonuclease 1 with essential Mg2+ cofactor
Class: lyase
Keywords: apurinic/apyrimidinic endonuclease, LYASE
Deposited on 2013-07-11, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APE, APE1, APEX, APEX1, APX, HAP1, REF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lnda_
  • Chain 'B':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APE, APE1, APEX, APEX1, APX, HAP1, REF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lndb_
  • Chain 'C':
    Compound: DNA-(apurinic or apyrimidinic site) lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: APE, APE1, APEX, APEX1, APX, HAP1, REF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lndc_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lndA (A:)
    gshmasgegpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdil
    clqetkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehd
    qegrvivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdln
    vaheeidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmn
    arsknvgwrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lndA (A:)
    lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
    lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
    sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
    kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
    yfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lndB (B:)
    gshmasgegpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdil
    clqetkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehd
    qegrvivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdln
    vaheeidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmn
    arsknvgwrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lndB (B:)
    lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
    lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
    sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
    kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
    yfllshsllpalcdskirskalgsdhcpitlylal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lndC (C:)
    gshmasgegpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdil
    clqetkcsenklpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehd
    qegrvivaefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdln
    vaheeidlrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmn
    arsknvgwrldyfllshsllpalcdskirskalgsdhcpitlylal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lndC (C:)
    lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
    lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
    sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
    kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
    yfllshsllpalcdskirskalgsdhcpitlylal