PDB entry 4ln8

View 4ln8 on RCSB PDB site
Description: The crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/2/2013) in complex with lstb
Class: viral protein
Keywords: receptor specificity, viral protein
Deposited on 2013-07-11, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN8
    Domains in SCOPe 2.07: d4ln8l_
  • Heterogens: CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ln8A (A:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    vstaeqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8A (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ln8B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8B (B:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ln8C (C:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    vstaeqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8C (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ln8D (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8D (D:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ln8E (E:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    vstaeqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8E (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ln8F (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8F (F:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ln8G (G:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    vstaeqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8G (G:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ln8H (H:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8H (H:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ln8I (I:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    vstaeqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8I (I:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4ln8J (J:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8J (J:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4ln8K (K:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhs
    vstaeqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8K (K:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ln8L (L:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln8L (L:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri