PDB entry 4ln3

View 4ln3 on RCSB PDB site
Description: The crystal structure of hemagglutinin from a H7N9 influenza virus (A/Shanghai/1/2013)
Class: viral protein
Keywords: receptor specificity, viral protein
Deposited on 2013-07-11, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.212
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1332244]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LN3
    Domains in SCOPe 2.06: d4ln3l_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ln3A (A:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhs
    gstaeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3A (A:)
    gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
    irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
    aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
    gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
    vkqrslllatgmknvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ln3B (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3B (B:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ln3C (C:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhs
    gstaeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3C (C:)
    gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
    irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
    aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
    gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
    vkqrslllatgmknvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ln3D (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3D (D:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ln3E (E:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhs
    gstaeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3E (E:)
    gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
    irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
    aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
    gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
    vkqrslllatgmknvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ln3F (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3F (F:)
    aiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfe
    lidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkr
    qlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ln3G (G:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhs
    gstaeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3G (G:)
    gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
    irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
    aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
    gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
    vkqrslllatgmknvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ln3H (H:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3H (H:)
    iagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfel
    idneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkrq
    lrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ln3I (I:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhs
    gstaeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3I (I:)
    gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
    irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
    aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
    gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
    vkqrslllatgmknvp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4ln3J (J:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3J (J:)
    iagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfel
    idneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkrq
    lrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4ln3K (K:)
    adpgdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgl
    lgtitgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgft
    ysgirtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhs
    gstaeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtf
    sfngafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkc
    pryvkqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3K (K:)
    gdkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgt
    itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysg
    irtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgst
    aeqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfn
    gafiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpry
    vkqrslllatgmknvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ln3L (L:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ln3L (L:)
    iagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfel
    idneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkrq
    lrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn