PDB entry 4lmx

View 4lmx on RCSB PDB site
Description: Light harvesting complex PE555 from the cryptophyte Hemiselmis andersenii CCMP644
Class: photosynthesis
Keywords: thylakoid lumen, PHOTOSYNTHESIS
Deposited on 2013-07-11, released 2014-06-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cryptophyte phycoerythrin (alpha-2 chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-61)
• Chain 'B':
  Compound: cryptophyte phycoerythrin (beta chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-176)
  Domains in SCOPe 2.04: d4lmxb_
• Chain 'C':
  Compound: cryptophyte phycoerythrin (alpha-1 chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-End)
• Chain 'D':
  Compound: cryptophyte phycoerythrin (beta chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (Start-176)
• Chain 'E':
  Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-End)
    • microheterogeneity (43-44)
    • microheterogeneity (50)
    • microheterogeneity (57-58)
    • microheterogeneity (60-61)
• Chain 'F':
  Compound: cryptophyte phycoerythrin (beta chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (Start-176)
• Chain 'G':
  Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-End)
    • microheterogeneity (43-44)
    • microheterogeneity (50)
    • microheterogeneity (57-58)
    • microheterogeneity (60-61)
• Chain 'H':
  Compound: cryptophyte phycoerythrin (beta chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (Start-176)
• Chain 'I':
  Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-End)
    • microheterogeneity (43-44)
    • microheterogeneity (50)
    • microheterogeneity (57-58)
    • microheterogeneity (60-61)
• Chain 'J':
  Compound: cryptophyte phycoerythrin (beta chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (Start-176)
• Chain 'K':
  Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (0-End)
    • microheterogeneity (43-44)
    • microheterogeneity (50)
    • microheterogeneity (57-58)
    • microheterogeneity (60-61)
• Chain 'L':
  Compound: cryptophyte phycoerythrin (beta chain)
  Species: Hemiselmis andersenii [TaxId:464988]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LMX (Start-176)
• Heterogens: PEB, DBV, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lmxB (B:)
  mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
  cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
  gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.