PDB entry 4lmx

View 4lmx on RCSB PDB site
Description: Light harvesting complex PE555 from the cryptophyte Hemiselmis andersenii CCMP644
Class: photosynthesis
Keywords: thylakoid lumen, PHOTOSYNTHESIS
Deposited on 2013-07-11, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cryptophyte phycoerythrin (alpha-2 chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-61)
  • Chain 'B':
    Compound: cryptophyte phycoerythrin (beta chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-176)
    Domains in SCOPe 2.07: d4lmxb_
  • Chain 'C':
    Compound: cryptophyte phycoerythrin (alpha-1 chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-End)
  • Chain 'D':
    Compound: cryptophyte phycoerythrin (beta chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (Start-176)
    Domains in SCOPe 2.07: d4lmxd_
  • Chain 'E':
    Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-End)
      • microheterogeneity (43-44)
      • microheterogeneity (50)
      • microheterogeneity (57-58)
      • microheterogeneity (60-61)
  • Chain 'F':
    Compound: cryptophyte phycoerythrin (beta chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (Start-176)
    Domains in SCOPe 2.07: d4lmxf_
  • Chain 'G':
    Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-End)
      • microheterogeneity (43-44)
      • microheterogeneity (50)
      • microheterogeneity (57-58)
      • microheterogeneity (60-61)
  • Chain 'H':
    Compound: cryptophyte phycoerythrin (beta chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (Start-176)
    Domains in SCOPe 2.07: d4lmxh_
  • Chain 'I':
    Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-End)
      • microheterogeneity (43-44)
      • microheterogeneity (50)
      • microheterogeneity (57-58)
      • microheterogeneity (60-61)
  • Chain 'J':
    Compound: cryptophyte phycoerythrin (beta chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (Start-176)
    Domains in SCOPe 2.07: d4lmxj_
  • Chain 'K':
    Compound: cryptophyte phycoerythrin (alpha-1/alpha-2 chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (0-End)
      • microheterogeneity (43-44)
      • microheterogeneity (50)
      • microheterogeneity (57-58)
      • microheterogeneity (60-61)
  • Chain 'L':
    Compound: cryptophyte phycoerythrin (beta chain)
    Species: Hemiselmis andersenii [TaxId:464988]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LMX (Start-176)
    Domains in SCOPe 2.07: d4lmxl_
  • Heterogens: PEB, DBV, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lmxB (B:)
    mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
    cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lmxD (D:)
    mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
    cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmxD (D:)
    dafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvce
    npsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
    paagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lmxF (F:)
    mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
    cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmxF (F:)
    ldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvc
    enpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslg
    vpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4lmxH (H:)
    mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
    cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmxH (H:)
    ldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvc
    enpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslg
    vpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4lmxJ (J:)
    mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
    cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmxJ (J:)
    dafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvce
    npsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
    paagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4lmxL (L:)
    mldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmv
    cenpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmxL (L:)
    dafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvce
    npsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
    paagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala