PDB entry 4lmr

View 4lmr on RCSB PDB site
Description: Crystal structure of L-lactate dehydrogenase from Bacillus cereus ATCC 14579, NYSGRC Target 029452
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, OXIDOREDUCTASE
Deposited on 2013-07-10, released 2013-07-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-31, with a file datestamp of 2013-07-26.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.164
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase 1
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1924, ldh, ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lmra1, d4lmra2
  • Chain 'B':
    Compound: L-lactate dehydrogenase 1
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_1924, ldh, ldh1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lmrb1, d4lmrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lmrA (A:)
    mhhhhhhssgvdlgtenlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdv
    neakaegeamdlshavpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlvekn
    akifkqivrsimdsgfdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrym
    lgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinv
    rdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavl
    nrggvreilevelsedeelkfdhsvqvlketmapvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmrA (A:)
    kginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapaptr
    vwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsgfdgifliat
    npvdiltyvtwkesglpkervigsgttldsarfrymlgeyfdigphnihayiigehgdte
    lpvwshvsvgiqklqtllekdntynqedldkifinvrdaayhiierkgatyygigmsllr
    vtkailndensvltvsaylegqygqkdvyigvpavlnrggvreilevelsedeelkfdhs
    vqvlketmapvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lmrB (B:)
    mhhhhhhssgvdlgtenlyfqsmkkginrvvlvgtgavgcsyaycminqavaeefvlvdv
    neakaegeamdlshavpfapaptrvwkgsyedckdadlvvitaglpqkpgetrldlvekn
    akifkqivrsimdsgfdgifliatnpvdiltyvtwkesglpkervigsgttldsarfrym
    lgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntynqedldkifinv
    rdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygqkdvyigvpavl
    nrggvreilevelsedeelkfdhsvqvlketmapvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lmrB (B:)
    kginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapaptr
    vwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsgfdgifliat
    npvdiltyvtwkesglpkervigsgttldsarfrymlgeyfdigphnihayiigehgdte
    lpvwshvsvgiqklqtllekdntynqedldkifinvrdaayhiierkgatyygigmsllr
    vtkailndensvltvsaylegqygqkdvyigvpavlnrggvreilevelsedeelkfdhs
    vqvlketmapvl