PDB entry 4lm6

View 4lm6 on RCSB PDB site
Description: Light harvesting complex PC612 from the cryptophyte Hemiselmis virescens M1635
Class: photosynthesis
Keywords: phycobiliprotein, thylakoid lumen, PHOTOSYNTHESIS
Deposited on 2013-07-10, released 2014-06-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cryptophyte phycocyanin alpha chain
    Species: Hemiselmis virescens [TaxId:77927]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4LM6 (0-61)
  • Chain 'B':
    Compound: cryptophyte phycocyanin beta chain
    Species: Hemiselmis virescens [TaxId:77927]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4LM6 (0-176)
    Domains in SCOPe 2.06: d4lm6b_
  • Chain 'C':
    Compound: cryptophyte phycocyanin alpha chain
    Species: Hemiselmis virescens [TaxId:77927]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4LM6 (0-61)
  • Chain 'D':
    Compound: cryptophyte phycocyanin beta chain
    Species: Hemiselmis virescens [TaxId:77927]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4LM6 (Start-176)
    Domains in SCOPe 2.06: d4lm6d_
  • Heterogens: CYC, DBV, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lm6B (B:)
    mldafskvitsadgkaayvggadlqalkkfvsdgnkrmdavnaivsnascivsdavsgmv
    cenpaliapnggvysnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnaravaimkatvngfinntaqqkklstpagdcsalaseaggyfdkvssala
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lm6D (D:)
    mldafskvitsadgkaayvggadlqalkkfvsdgnkrmdavnaivsnascivsdavsgmv
    cenpaliapnggvysnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
    gvpaagnaravaimkatvngfinntaqqkklstpagdcsalaseaggyfdkvssala
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lm6D (D:)
    dafskvitsadgkaayvggadlqalkkfvsdgnkrmdavnaivsnascivsdavsgmvce
    npaliapnggvysnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
    paagnaravaimkatvngfinntaqqkklstpagdcsalaseaggyfdkvssala