PDB entry 4lm6

View 4lm6 on RCSB PDB site
Description: Light harvesting complex PC612 from the cryptophyte Hemiselmis virescens M1635
Class: photosynthesis
Keywords: phycobiliprotein, thylakoid lumen, PHOTOSYNTHESIS
Deposited on 2013-07-10, released 2014-06-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cryptophyte phycocyanin alpha chain
  Species: Hemiselmis virescens [TaxId:77927]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LM6 (0-61)
• Chain 'B':
  Compound: cryptophyte phycocyanin beta chain
  Species: Hemiselmis virescens [TaxId:77927]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LM6 (0-176)
  Domains in SCOPe 2.04: d4lm6b_
• Chain 'C':
  Compound: cryptophyte phycocyanin alpha chain
  Species: Hemiselmis virescens [TaxId:77927]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LM6 (0-61)
• Chain 'D':
  Compound: cryptophyte phycocyanin beta chain
  Species: Hemiselmis virescens [TaxId:77927]
  Database cross-references and differences (RAF-indexed):
  • PDB 4LM6 (Start-176)
• Heterogens: CYC, DBV, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lm6B (B:)
  mldafskvitsadgkaayvggadlqalkkfvsdgnkrmdavnaivsnascivsdavsgmv
  cenpaliapnggvysnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyasl
  gvpaagnaravaimkatvngfinntaqqkklstpagdcsalaseaggyfdkvssala
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.