PDB entry 4lm5

View 4lm5 on RCSB PDB site
Description: Crystal structure of Pim1 in complex with 2-{4-[(3-aminopropyl)amino]quinazolin-2-yl}phenol (resulting from displacement of SKF86002)
Class: transferase/transferase inhibitor
Keywords: co-crystallization, SKF86002, fluorescence, inhibitor screening, kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-07-10, released 2014-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lm5a_
  • Heterogens: Q17, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lm5A (A:)
    mkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvp
    mevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsf
    fwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvy
    sppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhli
    rwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsksgpssgenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lm5A (A:)
    esqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgevpmevvllkkvssgf
    sgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhchn
    cgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhryhg
    rsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrpsdrpt
    feeiqnhpwmqdvllpqetaeihlh