PDB entry 4lll

View 4lll on RCSB PDB site
Description: Crystal structure of S. aureus MepR-DNA complex
Class: transcription/DNA
Keywords: multidrug resistance, winged helix-turn-helix, transcription repression, mepR operator, TRANSCRIPTION-DNA complex
Deposited on 2013-07-09, released 2014-05-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: 0.195
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (2-139)
  Domains in SCOPe 2.04: d4llla_
• Chain 'B':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (2-139)
• Chain 'C':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (2-139)
• Chain 'D':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (Start-139)
• Chain 'E':
  Compound: Palindromized mepR operator sequence
  
• Chain 'F':
  Compound: Palindromized mepR operator sequence
  
• Chain 'G':
  Compound: Palindromized mepR operator sequence
  
• Chain 'H':
  Compound: Palindromized mepR operator sequence
  
• Chain 'I':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (Start-139)
• Chain 'J':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (2-139)
• Chain 'K':
  Compound: Palindromized mepR operator sequence
  
• Chain 'L':
  Compound: Palindromized mepR operator sequence
  
• Chain 'M':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (Start-139)
• Chain 'O':
  Compound: MepR
  Species: Staphylococcus aureus [TaxId:1280]
  Gene: mepR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5Y812 (Start-139)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4lllA (A:)
  sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
  tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
  seeeneqmkanltkmlsslq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4lllA (A:)
  eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
  ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
  eeneqmkanltkmlsslq
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.