PDB entry 4lll

View 4lll on RCSB PDB site
Description: Crystal structure of S. aureus MepR-DNA complex
Class: transcription/DNA
Keywords: multidrug resistance, winged helix-turn-helix, transcription repression, mepR operator, TRANSCRIPTION-DNA complex
Deposited on 2013-07-09, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4llla_
  • Chain 'B':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lllb_
  • Chain 'C':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lllc_
  • Chain 'D':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4llld_
  • Chain 'E':
    Compound: Palindromized mepR operator sequence
  • Chain 'F':
    Compound: Palindromized mepR operator sequence
  • Chain 'G':
    Compound: Palindromized mepR operator sequence
  • Chain 'H':
    Compound: Palindromized mepR operator sequence
  • Chain 'I':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4llli_
  • Chain 'J':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lllj_
  • Chain 'K':
    Compound: Palindromized mepR operator sequence
  • Chain 'L':
    Compound: Palindromized mepR operator sequence
  • Chain 'M':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lllm_
  • Chain 'O':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lllo_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lllA (A:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllA (A:)
    eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lllB (B:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllB (B:)
    eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lllC (C:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllC (C:)
    eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lllD (D:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllD (D:)
    ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
    tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
    eneqmkanltkmlsslq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4lllI (I:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllI (I:)
    ftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgp
    tvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlsee
    eneqmkanltkmlsslq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4lllJ (J:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllJ (J:)
    eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
    eeneqmkanltkmlsslq
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4lllM (M:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllM (M:)
    sylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgptvs
    nllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqteqmkanltkml
    sslq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4lllO (O:)
    sneftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqr
    tgptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsql
    seeeneqmkanltkmlsslq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lllO (O:)
    ysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtgptv
    snllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlseeen
    eqmkanltkmlsslq