PDB entry 4lld

View 4lld on RCSB PDB site
Description: Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain lambda constant domain (IgG1 CH1:Clambda) at 1.19A
Class: immune system
Keywords: IgG domain, fragment of antibody, IMMUNE SYSTEM
Deposited on 2013-07-09, released 2014-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.146
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ig lambda-2 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGLC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lldb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lldB (B:)
    gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
    qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapteclesgketaaakferq
    hmdsstsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lldB (B:)
    qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
    snnkyaassylsltpeqwkshrsyscqvthegstvektvap