PDB entry 4ll3

View 4ll3 on RCSB PDB site
Description: Structure of wild-type HIV protease in complex with darunavir
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Hydrolase Inhibitor-darunavir, Hydrolase-Hydrolase Inhibitor complex, HIV-1 protease, TMC114
Deposited on 2013-07-09, released 2014-04-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WFL7 (0-98)
  Domains in SCOPe 2.08: d4ll3a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WFL7 (0-98)
  Domains in SCOPe 2.08: d4ll3b_
• Heterogens: 017, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ll3A (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ll3B (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf