PDB entry 4lkk

View 4lkk on RCSB PDB site
Description: The structure of hemagglutinin L226Q mutant (H3 numbering) from a avian-origin H7N9 influenza virus (A/Anhui/1/2013) in complex with human receptor analog 6'SLNLN
Class: Viral Protein
Keywords: homotrimer, virus attachment, membrane fusion, Viral Protein
Deposited on 2013-07-07, released 2013-11-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.238
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKK (0-313)
    Domains in SCOPe 2.04: d4lkka_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKK (0-167)
    Domains in SCOPe 2.04: d4lkkb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkkA (A:)
    iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
    ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
    ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
    tklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
    iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
    rslllatgmknvpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkkB (B:)
    lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
    qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
    vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn