PDB entry 4lkg

View 4lkg on RCSB PDB site
Description: The structure of hemagglutinin from a avian-origin H7N9 influenza virus (A/Shanghai/1/2013) in complex with avian receptor analog 3'SLNLN
Class: Viral Protein
Keywords: homotrimer, virus attachment, membrane fusion, Viral Protein
Deposited on 2013-07-07, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.247
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKG (0-315)
    Domains in SCOPe 2.07: d4lkga_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKG (0-169)
    Domains in SCOPe 2.07: d4lkgb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKG (0-315)
    Domains in SCOPe 2.07: d4lkgc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKG (0-169)
    Domains in SCOPe 2.07: d4lkgd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKG (0-315)
    Domains in SCOPe 2.07: d4lkge_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKG (0-169)
    Domains in SCOPe 2.07: d4lkgf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkgA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
    eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkgB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkgC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
    eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkgD (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkgE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
    eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lkgF (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr