PDB entry 4lkf

View 4lkf on RCSB PDB site
Description: crystal structure of pseudomonas aeruginosa lectin leca complexed with gala-wky at 1.64 a resolution
Deposited on 2013-07-07, released 2013-12-18
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecA pa1L PA2570
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: PA-I galactophilic lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecA pa1L PA2570
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: peptide WKYL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKF (0-3)
  • Chain 'D':
    Compound: peptide WKYL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 4LKF (0-End)
  • Heterogens: GAL, CA, PHB, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4lkfA (A:)
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4lkfB (B:)
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >4lkfC (C:)
wkyl

  • Chain 'D':
    Sequence, based on SEQRES records:
    >4lkfD (D:)
wkyl

    Sequence, based on observed residues (ATOM records):
    >4lkfD (D:)
w