PDB entry 4lka

View 4lka on RCSB PDB site
Description: Crystal Structure of MOZ double PHD finger histone H3K9ac complex
Deposited on 2013-07-07, released 2013-10-16
The last revision was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.165
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase KAT6A
    Species: Homo sapiens [TaxId:9606]
    Gene: H3FA, HIST1H3A, KAT6A, MOZ, MYST3, RUNXBP2, ZNF220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92794 (6-End)
      • expression tag (2-5)
  • Chain 'B':
    Compound: Histone H3.1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lkaA (A:)
    gshmlelphekdkpvaepipicsfclgtkeqnrekkpeeliscadcgnsghpsclkfspe
    ltvrvkalrwqciecktcsscrdqgknadnmlfcdscdrgfhmeccdppltrmpkgmwic
    qicrprkkgrkllqkk
    

    Sequence, based on observed residues (ATOM records):
    >4lkaA (A:)
    hmlelphekdkpvaepipicsfclgtkeqnrekkpeeliscadcgnsghpsclkfspelt
    vrvkalrwqciecktcsscrdqgknadnmlfcdscdrgfhmeccdppltrmpkgmwicqi
    crprkk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4lkaB (B:)
    artkqtarkstggkaprkqla
    

    Sequence, based on observed residues (ATOM records):
    >4lkaB (B:)
    artkqtarkstg