PDB entry 4lk8

View 4lk8 on RCSB PDB site
Description: Crystal structure of CyaY protein from Psychromonas ingrahamii in complex with Co(II)
Class: metal binding protein
Keywords: metal binding protein
Deposited on 2013-07-07, released 2014-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein cyaY
  Species: Psychromonas ingrahamii [TaxId:357804]
  Gene: cyaY, Ping_0042
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1SR01 (0-104)
  Domains in SCOPe 2.08: d4lk8a_
• Chain 'B':
  Compound: Protein cyaY
  Species: Psychromonas ingrahamii [TaxId:357804]
  Gene: cyaY, Ping_0042
  Database cross-references and differences (RAF-indexed):
  • Uniprot A1SR01 (0-104)
  Domains in SCOPe 2.08: d4lk8b_
• Heterogens: CO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lk8A (A:)
  mndsefiqladqlyqkieekieesgadvdydqngslltlefenhtkliinrqqplhqvwl
  atlenghhydynngkwiddrsgdefltflsaaifkqsketvdfte
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4lk8B (B:)
  mndsefiqladqlyqkieekieesgadvdydqngslltlefenhtkliinrqqplhqvwl
  atlenghhydynngkwiddrsgdefltflsaaifkqsketvdfte