PDB entry 4lk5

View 4lk5 on RCSB PDB site
Description: Crystal structure of a enoyl-CoA hydratase from Mycobacterium avium subsp. paratuberculosis K-10
Class: lyase
Keywords: PSI-BIOLOGY, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, New York Structural Genomics Research Consortium, NYSGRC, 028185, alpha/beta, enoyl-CoA hydratase, LYASE
Deposited on 2013-07-06, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium avium subsp. paratuberculosis [TaxId:262316]
    Gene: echA11, MAP_2639
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lk5a_
  • Chain 'B':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium avium subsp. paratuberculosis [TaxId:262316]
    Gene: echA11, MAP_2639
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lk5b_
  • Chain 'C':
    Compound: enoyl-coa hydratase
    Species: Mycobacterium avium subsp. paratuberculosis [TaxId:262316]
    Gene: echA11, MAP_2639
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lk5c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lk5A (A:)
    mhhhhhhssgvdlgtenlyfqsmpssaiatlapvagldvtlsdgvfsvtinrpdslnslt
    vpvitgiadameyaatdpevkvvriggagrgfssgagisaddvsdgggvppdeiileinr
    lvraiaalphpvvavvqgpaagvgvsialacdvvlasenaffmlaftkiglmpdggasal
    vaaavgriramqmallperlpaaealawglvtavypadefeaevdkviarllsgpavafa
    ktklainaatlteldpalqrefdgqsvllkspdfvegatafqqrrtpnftdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lk5A (A:)
    lapvagldvtlsdgvfsvtinrpdslnsltvpvitgiadameyaatdpevkvvriggagr
    gfssgagisppdeiileinrlvraiaalphpvvavvqgpaagvgvsialacdvvlasena
    ffmlaftkiglmpdggasalvaaavgriramqmallperlpaaealawglvtavypadef
    eaevdkviarllsgpavafaktklainaatlteldpalqrefdgqsvllkspdfvegata
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lk5B (B:)
    mhhhhhhssgvdlgtenlyfqsmpssaiatlapvagldvtlsdgvfsvtinrpdslnslt
    vpvitgiadameyaatdpevkvvriggagrgfssgagisaddvsdgggvppdeiileinr
    lvraiaalphpvvavvqgpaagvgvsialacdvvlasenaffmlaftkiglmpdggasal
    vaaavgriramqmallperlpaaealawglvtavypadefeaevdkviarllsgpavafa
    ktklainaatlteldpalqrefdgqsvllkspdfvegatafqqrrtpnftdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lk5B (B:)
    lapvagldvtlsdgvfsvtinrpdslnsltvpvitgiadameyaatdpevkvvriggagr
    gfssgaeiileinrlvraiaalphpvvavvqgpaagvgvsialacdvvlasenaffmlaf
    tkiglmpdggasalvaaavgriramqmallperlpaaealawglvtavypadefeaevdk
    viarllsgpavafaktklainaatlteldpalqrefdgqsvllkspdfvegatafqqpnf
    td
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lk5C (C:)
    mhhhhhhssgvdlgtenlyfqsmpssaiatlapvagldvtlsdgvfsvtinrpdslnslt
    vpvitgiadameyaatdpevkvvriggagrgfssgagisaddvsdgggvppdeiileinr
    lvraiaalphpvvavvqgpaagvgvsialacdvvlasenaffmlaftkiglmpdggasal
    vaaavgriramqmallperlpaaealawglvtavypadefeaevdkviarllsgpavafa
    ktklainaatlteldpalqrefdgqsvllkspdfvegatafqqrrtpnftdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lk5C (C:)
    pvagldvtlsdgvfsvtinrpdslnsltvpvitgiadameyaatdpevkvvriggagrgf
    ssgagideiileinrlvraiaalphpvvavvqgpaagvgvsialacdvvlasenaffmla
    ftkiglmpdggasalvaaavgriramqmallperlpaaealawglvtavypadefeaevd
    kviarllsgpavafaktklainaatlteldpalqrefdgqsvllkspdfvegatafqqrr
    tpnftd