PDB entry 4ljb

View 4ljb on RCSB PDB site
Description: Structure of a photobleached state of IrisFP under high intensity laser-light
Class: Fluorescent Protein
Keywords: Fluorescent protein, Photobleaching, Beta-Barrel, Decarboxylation
Deposited on 2013-07-04, released 2013-10-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.342
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-228)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4ljba_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (Start-228)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4ljbb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-228)
      • expression tag (4-5)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4ljbc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: Lobophyllia hemprichii [TaxId:46758]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-228)
      • chromophore (69)
      • engineered mutation (178)
      • engineered mutation (196)
    Domains in SCOPe 2.05: d4ljbd_
  • Heterogens: SO4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ljbA (A:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ljbA (A:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ljbB (B:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ljbB (B:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
    kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ljbC (C:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ljbC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ljbD (D:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsr
    ttykakekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ljbD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn