PDB entry 4lj1

View 4lj1 on RCSB PDB site
Description: ripd (rv1566c) from mycobacterium tuberculosis: a non-catalytic nlpc/p60 domain protein with two penta-peptide repeat units (pvqqa- pvqpa)
Deposited on 2013-07-04, released 2013-11-06
The last revision was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Invasion-associated protein
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: RVBD_1566c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lj1A (A:)
smdyqqitdvviarglsqrgvpfswagggisgptrgtgtgintvgfdasgliqyayagag
lklprssgqmykvgqkvlpqqarkgdlifygpegtqsvalylgkgqmlevgdvvqvspvr
tngmtpylvrvlgtqptpvqqapvqpa

    Sequence, based on observed residues (ATOM records):
    >4lj1A (A:)
yqqitdvviarglsqrgvpfswagggisgptrgtgtgintvgfdasgliqyayagaglkl
prssgqmykvgqkvlpqqarkgdlifygpegtqsvalylgkgqmlevgdvvqvspvrtng
mtpylvrvlgpvqpa