PDB entry 4lj0

View 4lj0 on RCSB PDB site
Description: Nab2 Zn fingers complexed with polyadenosine
Deposited on 2013-07-04, released 2013-10-09
The last revision was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.195
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nab2
    Species: Chaetomium thermophilum [TaxId:759272]
    Gene: CTHT_0057680, Nab2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nab2
    Species: Chaetomium thermophilum [TaxId:759272]
    Gene: CTHT_0057680, Nab2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: polyadenosine RNA
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: polyadenosine RNA
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: polyadenosine RNA
    Species: synthetic, synthetic
  • Heterogens: ZN, ACT, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lj0A (A:)
seqdckywpncanplcafrhptmppcrnggeckvpgckfthlktpckfrpctnrscpflh
eegqrg

    Sequence, based on observed residues (ATOM records):
    >4lj0A (A:)
eqdckywpncanplcafrhptmppcrnggeckvpgckfthlktpckfrpctnrscpflhe
egqrg

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4lj0B (B:)
seqdckywpncanplcafrhptmppcrnggeckvpgckfthlktpckfrpctnrscpflh
eegqrg

    Sequence, based on observed residues (ATOM records):
    >4lj0B (B:)
eqdckywpncanplcafrhptmppcrnggeckvpgckfthlktpckfrpctnrscpflhe
egqr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.